NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082015_1058247

Scaffold Ga0082015_1058247


Overview

Basic Information
Taxon OID3300006090 Open in IMG/M
Scaffold IDGa0082015_1058247 Open in IMG/M
Source Dataset NameMarine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMajor University, Chile
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)612
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Eastern Tropical South Pacific Oxygen Minumum Zone, Cruise Nbp1315, 2013

Source Dataset Sampling Location
Location NameEastern Topical South Pacific
CoordinatesLat. (o)-13.71Long. (o)-81.389Alt. (m)Depth (m)250
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007697Metagenome346N

Sequences

Protein IDFamilyRBSSequence
Ga0082015_10582471F007697N/AAVAKYFGLKCMVTIPHYPDHIRDSYRVNASLAQKFGAKVYGVGNPNISGPELDAKKLVGETGYFQIKFGMNGRQVMETIAQQVKNVPDHVTTVVGIAGSGLSMLGVALGCKLYNKNIKTIYPVALSGYVYKNKKMWYDRLPERAQFDGDFHVVQSEYPYQHKLKLKESLPLDQTYEAKAWDWMVKNIEPSEKVLFWDVGIKEYD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.