


| Basic Information | |
|---|---|
| Taxon OID | 3300006068 Open in IMG/M |
| Scaffold ID | Ga0081428_110358 Open in IMG/M |
| Source Dataset Name | Hotspring Microbial Communities from Mammoth Norris Corridor Bijah Spring, Yellowstone National Park, Wyoming, USA ? Sample 4, Mini-Metagenomics |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2977 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hotsprings → Mini-Metagenome - Microbial Communities From The Yellowstone National Park |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.761133 | Long. (o) | -110.7309 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092122 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081428_1103583 | F092122 | N/A | MFNTLLRHLGIPPKTEETQGPSNPNEVEVSAAIETAKEAMKKLIDSTLAAVSKIREMTSSIGLDPLLEIMRKAYEGLCFVIGLSTTPVSNTVSSNATS* |
| ⦗Top⦘ |