


| Basic Information | |
|---|---|
| Taxon OID | 3300006025 Open in IMG/M |
| Scaffold ID | Ga0075474_10184794 Open in IMG/M |
| Source Dataset Name | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 644 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Delaware Bay | |||||||
| Coordinates | Lat. (o) | 39.283 | Long. (o) | -75.3633 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010392 | Metagenome / Metatranscriptome | 304 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075474_101847941 | F010392 | N/A | KRETKMVEENKTENVEEPTVKFAEDGKEHKVNEMPNNAKELYLLWQEEKQNRDNFIINANKSIDKLNRILSSYESDMKNILEPADEPKIEVSK* |
| ⦗Top⦘ |