NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080027_10008042

Scaffold Ga0080027_10008042


Overview

Basic Information
Taxon OID3300005993 Open in IMG/M
Scaffold IDGa0080027_10008042 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3845
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)68.6139Long. (o)-149.3145Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000063Metagenome / Metatranscriptome2803Y
F000275Metagenome / Metatranscriptome1391Y

Sequences

Protein IDFamilyRBSSequence
Ga0080027_100080421F000063N/AMLTEGVWAEVLVGKEHLRLFSEKNAQGTQASVYNVNTKNWIAPSEAVEDIDQGKDKTTEYARIYLRHVTDSELPPLEWKTSRSR*
Ga0080027_100080423F000275GGAMVAEFVTSGMRRSEFCRSRGLSFGTLNRHLKKQRWKRKSRAASSAVQFGRLVPVELAAKKSPTQHETSCGLAVVLSGGHRIEVHPDFDTNTFQRLVSTLDRV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.