


| Basic Information | |
|---|---|
| Taxon OID | 3300005856 Open in IMG/M |
| Scaffold ID | Ga0080005_134882 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4446 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Betalipothrixvirus → Sulfolobus islandicus filamentous virus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Joseph's Coat, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026923 | Metagenome | 196 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0080005_1348822 | F026923 | AGGAGG | MSDRMPIRLKVDITYDDVIRIFNEIEQKIRAEVVKLLPYPDVKLTLTSFCLHKTVDDLYVVILKYKADVRYLDLGDTKNIDVVIRSDGTYAVL* |
| ⦗Top⦘ |