


| Basic Information | |
|---|---|
| Taxon OID | 3300005825 Open in IMG/M |
| Scaffold ID | Ga0074476_1491870 Open in IMG/M |
| Source Dataset Name | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 610 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ilwaco, Washington, USA | |||||||
| Coordinates | Lat. (o) | 46.28562 | Long. (o) | -124.05179 | Alt. (m) | Depth (m) | .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077325 | Metagenome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074476_14918702 | F077325 | N/A | IKAIIVNMINQKHMFRDLGEKGELPKSFKIQNSQEYVLGIFTGIVINLFANYWVGEHEKGLLPEDLEYLYHQIAISYDMIKTGLFE* |
| ⦗Top⦘ |