


| Basic Information | |
|---|---|
| Taxon OID | 3300005808 Open in IMG/M |
| Scaffold ID | Ga0079972_13527 Open in IMG/M |
| Source Dataset Name | Basalt sediment microbial communities from the East Pacific Rise Rocks |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 622 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From The East Pacific Rise |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.725 | Long. (o) | -104.16 | Alt. (m) | Depth (m) | 2674 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093890 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079972_135271 | F093890 | GGA | VRPRLRFFLFLLSWILSISLFSTVLWANPTFLNRQAYPLPLGLHEIGQFHNNDLKTFEVWTQWSNPSNEKXVVKVTXSFYDKDSADSQLGEDGKDDLLMTVTESVTIPEQTSNWGKYFQLTAIGHKLNQGFDHPGEGAGLELYLDAQVISVKHLP |
| ⦗Top⦘ |