


| Basic Information | |
|---|---|
| Taxon OID | 3300005782 Open in IMG/M |
| Scaffold ID | Ga0079367_1010823 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aarhus University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4555 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Aarhus Bay station M5 | |||||||
| Coordinates | Lat. (o) | 56.10555 | Long. (o) | 10.463333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019930 | Metagenome / Metatranscriptome | 227 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079367_10108237 | F019930 | AGGAG | MRKLNLSDYTIKIKAPDRMNPGQEIDAEFPYRVKDSILNLMFIKELQLSGAELVKQNVLAMKIEGCKNEVLLEEDEYQRVKKAIDTFKGFTRYDVELVTRITEAEVVEVQSK* |
| ⦗Top⦘ |