


| Basic Information | |
|---|---|
| Taxon OID | 3300005760 Open in IMG/M |
| Scaffold ID | Ga0078205_141075 Open in IMG/M |
| Source Dataset Name | Algae and Fungi communities from freshwater lake in Auvergne, France - sample AST3 at day 1 of algae bloom |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institut Pasteur, Lille, France |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1344 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Auvergne, France | |||||||
| Coordinates | Lat. (o) | 45.495847 | Long. (o) | 2.887922 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092089 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078205_1410752 | F092089 | N/A | MLLVSQTMKLLSSIGIVLALSISFAFAGKSTFKFPGGLDKKKYVSSNIGKRILKGNSKKGSIVKKNKRKGARASTNTAPTIAQSYVNWVVCLHDRTSNKACSPQLGVPKGYYFLDPFVVYSSCSNTTIPVRKCNVAVDPKGEPLTVVIPVAVAFYFSYDNDPKGGICNETRPTGNDLLYVKTNVVNDDFNYTQLPYAFVNGRSLSMEYIIEDEPFYLKSCSNKVQCCDDCDVPSCVDCGGVDQYPTIGYVSTDTSTWKPGEKRYYQWGYGYEVDACDCSGCSMGRVELTAVEKK* |
| ⦗Top⦘ |