


| Basic Information | |
|---|---|
| Taxon OID | 3300005758 Open in IMG/M |
| Scaffold ID | Ga0078117_1047214 Open in IMG/M |
| Source Dataset Name | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1794 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.411221 | Long. (o) | 103.905587 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055466 | Metagenome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078117_10472142 | F055466 | N/A | VWIDRDHIPSDQFWEVFAPDSFQEQREQVRRKHNKEYWPEKEKSLQELSLQAYSKEHYRSIDSIEIVLKIDNQENIYHRVVIADSRGLPIKYNTLKPYSSEEIHQFVNTKYQNWYKAGGYFYHKFYRSYPTFWIDLWEIIAQEYPILLEWYLPEVEEVDIQVLAEEEESRQQGIK* |
| ⦗Top⦘ |