


| Basic Information | |
|---|---|
| Taxon OID | 3300005613 Open in IMG/M |
| Scaffold ID | Ga0074649_1050945 Open in IMG/M |
| Source Dataset Name | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1798 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Greece: Etoliko Lagoon | |||||||
| Coordinates | Lat. (o) | 38.4825 | Long. (o) | 21.315 | Alt. (m) | Depth (m) | 25 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030291 | Metagenome / Metatranscriptome | 186 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074649_10509452 | F030291 | AGGAG | MPMPKSVLNTLIKLRHMSGEEIREYFQKRADFHSKYPNNPKSKFTAKDWAIDQEKWHGLKNERTYSKHFE* |
| ⦗Top⦘ |