


| Basic Information | |
|---|---|
| Taxon OID | 3300005582 Open in IMG/M |
| Scaffold ID | Ga0049080_10291521 Open in IMG/M |
| Source Dataset Name | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 527 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Lakes, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 44.504638 | Long. (o) | -83.045851 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023094 | Metagenome / Metatranscriptome | 211 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0049080_102915211 | F023094 | GGAG | MTTLAAIQGNGWCVIGCDSRASEESGRYTTMATHKVIENGPYLIAGAGASRGSNILQFGWTPPKPPNSVENLDSFMTKKFVPEMRRAFIEAGYDMKEDGDAAAHDSMFLVAVRGVIYPIFEDYSWDRDVRNVYYGGSGGDV |
| ⦗Top⦘ |