


| Basic Information | |
|---|---|
| Taxon OID | 3300005560 Open in IMG/M |
| Scaffold ID | Ga0066670_10157072 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1334 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California: Angelo Coastal Reserve | |||||||
| Coordinates | Lat. (o) | 39.7392 | Long. (o) | -123.6308 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015161 | Metagenome / Metatranscriptome | 257 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066670_101570721 | F015161 | GAGG | MADDSKGVLGHLPPLPRAALNNSVIAMEQAYRKRKGLPLISDADVEALKAGTPMSWEEGGSGVVASAPTASAL |
| ⦗Top⦘ |