NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070663_100599469

Scaffold Ga0070663_100599469


Overview

Basic Information
Taxon OID3300005455 Open in IMG/M
Scaffold IDGa0070663_100599469 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)926
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F000805Metagenome / Metatranscriptome883Y
F001079Metagenome / Metatranscriptome785Y

Sequences

Protein IDFamilyRBSSequence
Ga0070663_1005994691F000805N/AYQYLQAHQETMQRAATWHVRWVDLAWLWGFVIVLSLVAIWWVWQYRTTRQKTGIYPVDSFGGYTTELAGPSTLFFLLLTAIVAGFAVVLIVGHLVWGQKF*
Ga0070663_1005994692F001079AGAAGMEGEIVTEALPYVAWSSSSVVVVPAADWPRVFASMQALKGHVQEHPGCQKLEAFVAEDDAGYRVHVYTTWDTPEQLEAYLTRGYTFERMLADVADLDAEAPQVMEKIF*
Ga0070663_1005994693F000280GGAGMPEDGRQQPARPLSGYRDVGEDVRHSRGSLIRAWIILAVLVLFYLGWTLTVYFLEPGLR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.