


| Basic Information | |
|---|---|
| Taxon OID | 3300005452 Open in IMG/M |
| Scaffold ID | Ga0068706_1006165 Open in IMG/M |
| Source Dataset Name | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3556 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming: Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.963 | Long. (o) | -110.715 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002970 | Metagenome / Metatranscriptome | 517 | N |
| F005302 | Metagenome / Metatranscriptome | 405 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068706_10061651 | F005302 | GGAGG | MSHTGIIDGLFAGNYAVEISTNGTTWTAVSNATVKIDDIELSRPSGEAYVGGSSDYATVTIGKREPVEITLTFLYSEAANSAANTVFDAFQSANPRLGVRWSPRGLVGGARAYATSNDGATFGLGVITGVTHSALDPSDPEPFVAMVTVRAPAIRQY |
| Ga0068706_10061652 | F002970 | GGAG | MSSSTVINIVELLAGLAVQYNNATVSVRRLTTQTNWVDAAQLPVRIIPALGGLRLVDGGVYTATRATRAVWEIDDLLLVRDVGMGRGVADTATALVRYIEEYVALLRFAWRVRGDVQLINVSGMIDVVRYGERAYEGVTMTVRFAHLVRAPSA* |
| ⦗Top⦘ |