


| Basic Information | |
|---|---|
| Taxon OID | 3300005338 Open in IMG/M |
| Scaffold ID | Ga0068868_100553493 Open in IMG/M |
| Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1014 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan, Kellogg Biological Station | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010057 | Metagenome / Metatranscriptome | 309 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068868_1005534932 | F010057 | N/A | MTLMAAVLTLMFAAAGERAALIVAGADAPARMDRATVLTPAEGPPIVLYAATNLTDQPLDQFTVMAFVFKADGTLKARQAAPARRTLDAKETKYSALVLDGSTIEPTDIIVIGINQAQRVGSETWWRTDLQPAAEAAVPLKKR* |
| ⦗Top⦘ |