


| Basic Information | |
|---|---|
| Taxon OID | 3300005239 Open in IMG/M |
| Scaffold ID | Ga0073579_1297682 Open in IMG/M |
| Source Dataset Name | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 843 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Environmental Genome Shotgun Sequencing: Ocean Microbial Populations From The Gulf Of Maine |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Maine, USA | |||||||
| Coordinates | Lat. (o) | 43.2393 | Long. (o) | -68.368612 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042348 | Metagenome / Metatranscriptome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073579_12976822 | F042348 | N/A | MKLDQLRKIIREEVRSAVKDELQEMLNEAVKAASAPSTQEYKAVKQKDLKRTWSTGKMNPGTVPLEEMLNMTKEEMTGQDFRNVVGADSSMVKKPNFASGMAQSMGMTENKGPMPGIDISKLDFVSKAKAVLDKSYEKDKNRLG* |
| ⦗Top⦘ |