


| Basic Information | |
|---|---|
| Taxon OID | 3300005222 Open in IMG/M |
| Scaffold ID | Ga0073351_118521 Open in IMG/M |
| Source Dataset Name | Norris Geyser Basin Perpetual Spouter 2 - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Stanford University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1462 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Tepid (25-34C) → Unclassified → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.726683 | Long. (o) | -110.70915 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074102 | Metagenome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0073351_1185211 | F074102 | N/A | FSFKDITHQQMVDYLNDNHPISLKHNEDLVNRVYARYPILDKSEVGIIIKAVFASFRDLLVLGKVLNFNSLFFDTKLHFFDHRRDGRILPSLKVRISTPPKLRKHDKK* |
| ⦗Top⦘ |