| Basic Information | |
|---|---|
| Taxon OID | 3300005093 Open in IMG/M |
| Scaffold ID | Ga0062594_100023950 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2641 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 42.4 | Long. (o) | -85.37 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000805 | Metagenome / Metatranscriptome | 883 | Y |
| F001079 | Metagenome / Metatranscriptome | 785 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0062594_1000239503 | F000805 | AGGAGG | MAMPSGSSPEKSQQFYHYLQAHQLTMQKADTWHVRWMDLAWLWGFVIVLSLAIIWWVWQYRSTRQKTGIYPIDSFGGFTTEMAGPATLFFLLLTVVLVGFAVVLIVGHIVWGQKF* |
| Ga0062594_1000239504 | F001079 | AGAAG | MATAEGATAASALPYVAWSSETVAVIPAADWPLVYSSLQALKGHVQEYPGCQKLEAFVAVSDGSFRIDCYTTWDTPEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |