


| Basic Information | |
|---|---|
| Taxon OID | 3300005077 Open in IMG/M |
| Scaffold ID | Ga0071116_1140267 Open in IMG/M |
| Source Dataset Name | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1128 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole → Water Filled Karst Sinkhole Microbial Communities From Little Salt Spring, North Port, Florida |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Port, Florida | |||||||
| Coordinates | Lat. (o) | 27.074722 | Long. (o) | -82.233333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013067 | Metagenome / Metatranscriptome | 274 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071116_11402674 | F013067 | N/A | YRFVNAGSDTVFLGTGASAAEATANAVAPVAGNPSPAVVLVPGAVEILRFNKDTYFSGLASGATTVYVTPGQGI* |
| ⦗Top⦘ |