


| Basic Information | |
|---|---|
| Taxon OID | 3300005069 Open in IMG/M |
| Scaffold ID | Ga0071350_1242279 Open in IMG/M |
| Source Dataset Name | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 627 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Fryxell, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.611214 | Long. (o) | 163.119356 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076855 | Metagenome / Metatranscriptome | 117 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0071350_12422791 | F076855 | N/A | LLFDWFGISCKATENFCFYLQKRLIQTSQTGDQQHGDTSPCSIPWSLL* |
| ⦗Top⦘ |