NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068513_1015188

Scaffold Ga0068513_1015188


Overview

Basic Information
Taxon OID3300004951 Open in IMG/M
Scaffold IDGa0068513_1015188 Open in IMG/M
Source Dataset NameMarine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)820
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameEast Sea, Korea
CoordinatesLat. (o)37.0Long. (o)131.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000754Metagenome / Metatranscriptome906Y

Sequences

Protein IDFamilyRBSSequence
Ga0068513_10151882F000754N/ATMDFTVNNAEFSKDASVSTLVTGQPFGWSGTGYVMNDMVTTGSVRNRPVITFTNGTAGTRTVDVAVFIGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.