NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0062378_10002042

Scaffold Ga0062378_10002042


Overview

Basic Information
Taxon OID3300004780 Open in IMG/M
Scaffold IDGa0062378_10002042 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2753
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation

Source Dataset Sampling Location
Location NameUSA: Michigan, St. Louis River estuary
CoordinatesLat. (o)46.6972164Long. (o)-92.3279105Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001089Metagenome / Metatranscriptome781Y

Sequences

Protein IDFamilyRBSSequence
Ga0062378_100020423F001089AGGAVTSAESDYLLRLAALSLSFVGFSAVVVTLRGALGGELSDRHLRLVRLYIEGGLLVTALALVPTLLNLLHVPGNVTWPLSSATAGSIFTLVLLIQFRRRRAIEPGRLPPWVVVIYALSTVAVAGLWFNVAGVPFPPGVGPYAVALTWALCVFGFIFVRTIELFLHRPPHA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.