


| Basic Information | |
|---|---|
| Taxon OID | 3300004760 Open in IMG/M |
| Scaffold ID | Ga0068404_100962 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Formosa Ridge, South China Sea G1-3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 544 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment → Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South China Sea, offshore southwestern Taiwan | |||||||
| Coordinates | Lat. (o) | 22.11546667 | Long. (o) | 119.28443333 | Alt. (m) | Depth (m) | 1146 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104423 | Metagenome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068404_1009621 | F104423 | AGGAG | VEVHRIRKAKSLYHRERYHILLEVEKDRWLEIESLNGVTYDSIQTFLKSEKETGIRVVGFTDKSFQWGTIKDWNHSGIIKNLKIKK* |
| ⦗Top⦘ |