


| Basic Information | |
|---|---|
| Taxon OID | 3300004628 Open in IMG/M |
| Scaffold ID | Ga0070399_1000428 Open in IMG/M |
| Source Dataset Name | Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4 (version 1) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 47929 |
| Total Scaffold Genes | 40 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (47.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lawrence Berkeley National Laboratory, California, USA | |||||||
| Coordinates | Lat. (o) | 37.8754404 | Long. (o) | -122.2477251 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007590 | Metagenome / Metatranscriptome | 348 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070399_100042839 | F007590 | N/A | MEHPESPSGRYQAQIAVAKKVLEQKEDWANRAEWEVVKTRDGWEVYAWRVEHPKAKGAKRYLPWGYSVIELDNGLVPLTYHKKG* |
| ⦗Top⦘ |