NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063356_100056113

Scaffold Ga0063356_100056113


Overview

Basic Information
Taxon OID3300004463 Open in IMG/M
Scaffold IDGa0063356_100056113 Open in IMG/M
Source Dataset NameCombined assembly of Arabidopsis thaliana microbial communities
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4004
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Walnut Creek, California
CoordinatesLat. (o)37.931388Long. (o)-122.021761Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000174Metagenome / Metatranscriptome1764Y
F088408Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0063356_1000561133F088408N/AMQAVTSVEMEEVLAQYPGLFCVGRELRFDHPEAKFVTLKLNCLEPHQLVELARLAAHLFYQEQHFAGAALWITQSGVWTEPVESVARNTIERIRQGYGENRSLEVAPGHFFRSDEFVDSVSLLLQPMLVGWDAFYVPRWTSGALDYFLFVSHDSLLEIHTRTAEASAKATQLLASLKWIQDSVGNSIASSSRPL*
Ga0063356_1000561135F000174AGCAGGMKNVYEVLRQKELELARLEKEVEALRVAAPLLSEDKEMSADAPKPTLTTAPPSQQPIRIPQPAVQAAAPQARAAGWEDTAKRWP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.