


| Basic Information | |
|---|---|
| Taxon OID | 3300004448 Open in IMG/M |
| Scaffold ID | Ga0065861_1039089 Open in IMG/M |
| Source Dataset Name | Marine viral communities from Newfoundland, Canada BC-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7046 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium 6E | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Newfoundland, Canada | |||||||
| Coordinates | Lat. (o) | 47.593411 | Long. (o) | -52.885466 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009843 | Metagenome / Metatranscriptome | 312 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0065861_10390895 | F009843 | N/A | MKKVELGGQERPIRFSYLCLKEICKKLGLKLNELNQLGSEIDHIGVIAYFGLKYGAKKIGEKFTYKIADIEEWLDNEDFSKISEIFEAFQLDQPQGEGK* |
| ⦗Top⦘ |