


| Basic Information | |
|---|---|
| Taxon OID | 3300004280 Open in IMG/M |
| Scaffold ID | Ga0066606_10091537 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1156 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060433 | Metagenome | 133 | Y |
| F102085 | Metagenome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066606_100915371 | F102085 | N/A | MATSIYIFDSDKMFNAIYREHVNELEYKMPLIDLYVKGQKLWVVTNSNDMKEQPRLDRSIVHFRKDNAKEWIEGDEKLVLHGKIRYNHKKNQLELFPRFLRKPLLSMRVGRFFGNKKGKCYIDFNKRYYDFNNDRMI |
| Ga0066606_100915373 | F060433 | N/A | MEISAIIETLLIACILGMGGALFGFFRKMSSTQKDLCDTVSRLQKTLIILAKAVDKQSNRLHPEEANSELDDLVKELLDKP* |
| ⦗Top⦘ |