


| Basic Information | |
|---|---|
| Taxon OID | 3300004097 Open in IMG/M |
| Scaffold ID | Ga0055584_100169037 Open in IMG/M |
| Source Dataset Name | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2210 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Helgoland, North Sea, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 54.18194 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009991 | Metagenome / Metatranscriptome | 310 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0055584_1001690373 | F009991 | N/A | MHYKSMVYQLNSLRLGLVHEDNIYGKPTIFVAMGSQSPDIETHIDHYNDLIAKNEKHIIAIPFDNNGTEPGDDYEIVAHYENILGFKSYVTEKINAKHKFFEDFGMPVDDFTEYHFDDKTRFVRKV* |
| ⦗Top⦘ |