


| Basic Information | |
|---|---|
| Taxon OID | 3300003976 Open in IMG/M |
| Scaffold ID | Ga0064219_12151 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Barrow, Alaska NGEE-2011 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1560 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Ngee-Artic Barrow Site, Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Barrow, Alaska | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095392 | Metagenome / Metatranscriptome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064219_121513 | F095392 | GGAG | MLATLVTASTNAVQVFALIAVILFIIAGIIAFRDKTLWATLICAGLAFPSAAEMYLA* |
| ⦗Top⦘ |