


| Basic Information | |
|---|---|
| Taxon OID | 3300003962 Open in IMG/M |
| Scaffold ID | Ga0064068_110284 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Ingolstadt, Germany, from a nitrification basin |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aalborg University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 789 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Communities From Ingolstadt, Germany, From A Nitrification Basin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ingolstadt, Germany | |||||||
| Coordinates | Lat. (o) | 48.7 | Long. (o) | 11.42 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024268 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064068_1102841 | F024268 | GGAGG | MAITELYSGTEAVGTTEHSCTTDTAGPDVDTTDGVFQVFLDVSDMIAGDQLQIRIYEKVRSADTQRIVYEAILTGPQIHPIWVSPSLVLMHGWDVTLDALAGTITVNWSIRQVT* |
| ⦗Top⦘ |