NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0056904_1050768

Scaffold Ga0056904_1050768


Overview

Basic Information
Taxon OID3300003778 Open in IMG/M
Scaffold IDGa0056904_1050768 Open in IMG/M
Source Dataset NameWastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_9/17/2007_ DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)519
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Source Dataset Sampling Location
Location NameMadison, Wisconsin, USA
CoordinatesLat. (o)43.076217Long. (o)-89.411742Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001089Metagenome / Metatranscriptome781Y

Sequences

Protein IDFamilyRBSSequence
Ga0056904_10507681F001089N/ASDPAADPASLPISCDCATDQAAIVTSAESDYLFRLAALSLTFVGFSSVVVTLQGRLGGELSDRHLRLVRLYIEGGFLVTALALVPTLLTFVQVPDRFVWPLSSAAAGAIFTLVLLIQFRRRRQVEPGRFPAWVIVIYVLSVAVVGALWLNVVGVPSPSRAGPYAVALTWALG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.