


| Basic Information | |
|---|---|
| Taxon OID | 3300003752 Open in IMG/M |
| Scaffold ID | Ga0055539_1001120 Open in IMG/M |
| Source Dataset Name | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5545 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.6667 | Long. (o) | -78.5097 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028856 | Metagenome / Metatranscriptome | 190 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0055539_10011203 | F028856 | GGAGG | MDNFPAGQARGARFEPGAMLNIDDPFELLHADDNLGDEAAFPSTWQDLDAGDAPHE* |
| ⦗Top⦘ |