


| Basic Information | |
|---|---|
| Taxon OID | 3300003450 Open in IMG/M |
| Scaffold ID | DC07A_1046232 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S7-DC07A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 525 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Douglas Channel, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 53.6667 | Long. (o) | -129.1333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104035 | Metagenome | 101 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DC07A_10462322 | F104035 | AGGAG | MTKTKEIKEKTIEKARKDAENDYQGGGAYRAFLEMFYKNKIEEDKKNGQKNSEDV* |
| ⦗Top⦘ |