


| Basic Information | |
|---|---|
| Taxon OID | 3300003332 Open in IMG/M |
| Scaffold ID | GBSed_10042909 Open in IMG/M |
| Source Dataset Name | Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2144 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment → Marine Hydrothermal Vent Sediment Microbial Communities From Guaymas Basin, Gulf Of California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guyams Basin, Gulf of California, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 27.01 | Long. (o) | -111.43 | Alt. (m) | Depth (m) | 2000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046123 | Metagenome | 151 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GBSed_100429093 | F046123 | GGAGG | MSCPYKEGSEYCWLCWNWNEYEEYCILPEEERQFELIDEFKDIDSKTYNERMQMLKDMGLIPLHRAVKAGFVKQQRTLSDFGVVMSHE* |
| ⦗Top⦘ |