


| Basic Information | |
|---|---|
| Taxon OID | 3300003301 Open in IMG/M |
| Scaffold ID | Ga0005239J48904_1005965 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_10m (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5053 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (88.89%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.7299 | Long. (o) | -123.5699 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019481 | Metagenome / Metatranscriptome | 229 | Y |
| F047705 | Metagenome / Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0005239J48904_10059655 | F047705 | GGAGG | MSLSAKVTTAVNKAFTAAGDLVKQGTLSTKAVSTYDFGTRQTVSTITSQTVDVIIQSSQKPSGEGFTITALMKSGVDISVYDVLTVSSKVYNIIDYTDNNFTIEAILTKEAQ* |
| Ga0005239J48904_10059656 | F019481 | AGGAGG | MYDNVLQDIEAVFATSTWTINNIDIYPDNYQGTISDQNEFCRLNVLPSNSQHYAHGGNKEIDGLVAVKIFVKAGEGQARIMAISDILDISLQNKKLTNGTELGTSYLNVEGLDPSNKALYSARYVIPFKLYGA* |
| ⦗Top⦘ |