


| Basic Information | |
|---|---|
| Taxon OID | 3300003279 Open in IMG/M |
| Scaffold ID | FCL3draft_1000887 Open in IMG/M |
| Source Dataset Name | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - U3-798FC-DHS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 37125 |
| Total Scaffold Genes | 41 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (60.98%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: University of Illionis | |||||||
| Coordinates | Lat. (o) | 40.114056 | Long. (o) | -88.226756 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009010 | Metagenome / Metatranscriptome | 324 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FCL3draft_100088712 | F009010 | GGTGG | MVDLPESFYLLVNQPMLIVLPILVFAALALWSRSFTAALCAVAWNLYLIYELGMKAGEFCDGSACLKRTPLYLVYPVLAILSLVALVQVYVHLRDKRQRLNGIAPPRQEA* |
| ⦗Top⦘ |