


| Basic Information | |
|---|---|
| Taxon OID | 3300003278 Open in IMG/M |
| Scaffold ID | U2draft_1000071 Open in IMG/M |
| Source Dataset Name | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - U2-648F-DHS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 160508 |
| Total Scaffold Genes | 131 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (19.08%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: University of Illionis | |||||||
| Coordinates | Lat. (o) | 40.114056 | Long. (o) | -88.226756 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032328 | Metagenome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| U2draft_100007156 | F032328 | N/A | MVATFQAIAQTGSFDVFTYQHPEFFTKSKLPSEVNLKMTDKDGSFCTITLHKSQSAKKNALTDVISQWNEQVVKRLAKANKKPARIMTEQLWDRWVSTLAIGNFYKNKKKAVVILNSFRKGKMTACVVFAMSDKTFKGVIENFSKNLHLIDQ* |
| ⦗Top⦘ |