


| Basic Information | |
|---|---|
| Taxon OID | 3300003115 Open in IMG/M |
| Scaffold ID | Ga0052267_104590 Open in IMG/M |
| Source Dataset Name | Acid mine drainage microbial communities from Los Rueldos abandoned mercury mine in Spain - Sample B2A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Institute of Catalysis, The Higher Council for Scientific Research (CSIC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 939 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mogao stream, Los Rueldos, Spain | |||||||
| Coordinates | Lat. (o) | 43.25 | Long. (o) | -5.7666667 | Alt. (m) | Depth (m) | .03 to .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063194 | Metagenome / Metatranscriptome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052267_1045901 | F063194 | N/A | SLTQQYASLNVLLSQLQTTSSYLTQAFAALPNAPKGTSSGG* |
| ⦗Top⦘ |