


| Basic Information | |
|---|---|
| Taxon OID | 3300003098 Open in IMG/M |
| Scaffold ID | Ga0052264_102069 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from surface seawater at Gulf of Maine |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 30546 |
| Total Scaffold Genes | 44 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 15 (34.09%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater At Gulf Of Maine |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Maine | |||||||
| Coordinates | Lat. (o) | 43.14 | Long. (o) | -68.33 | Alt. (m) | Depth (m) | 1.5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055778 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0052264_10206924 | F055778 | N/A | MFSNVDFPEPDAPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| ⦗Top⦘ |