


| Basic Information | |
|---|---|
| Taxon OID | 3300002854 Open in IMG/M |
| Scaffold ID | pct2_10028241 Open in IMG/M |
| Source Dataset Name | Lignocellulose-degrading enriched microbial communities from Concordia, Entre Rios, Argentina - CMC-Pine-T2-ill-ass |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | INDEAR Instituto de Agrobiotecnologia Rosario |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2322 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Lignocellulose-Degrading Enriched → Lignocellulose-Degrading Enriched Microbial Communities From Concordia, Entre Rios, Argentina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Argentina: Entre Rios | |||||||
| Coordinates | Lat. (o) | -31.372253 | Long. (o) | -58.116672 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096514 | Metagenome / Metatranscriptome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| pct2_100282411 | F096514 | AGGAG | MDLVDLYHRRGIALVRSKLRGSAAARRGYGRLARLYSEQIERQRGAPTVVPELTPAL* |
| ⦗Top⦘ |