


| Basic Information | |
|---|---|
| Taxon OID | 3300002837 Open in IMG/M |
| Scaffold ID | bg3kmer60_1020233 Open in IMG/M |
| Source Dataset Name | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1949 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanomicrobiaceae → Methanofollis → Methanofollis ethanolicus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Sk?ne County | |||||||
| Coordinates | Lat. (o) | 55.656904 | Long. (o) | 13.082968 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033857 | Metagenome / Metatranscriptome | 176 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| bg3kmer60_10202332 | F033857 | AGCAGG | MVEIIDLSTLSPKPVIVKVGNGEEIEEIDLTIVPARGTLLLSEATQRHGGWEKIPDDEMIPAIAAICGQANPKITAEWLETKLTRPQLAGLTQVVLAQAFRRWGDKKDDNEQEHSEKNR* |
| ⦗Top⦘ |