


| Basic Information | |
|---|---|
| Taxon OID | 3300002822 Open in IMG/M |
| Scaffold ID | BMAI_1212200 Open in IMG/M |
| Source Dataset Name | Illumina_Fosmid_Bertioga |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1498 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South America Atlantic Tropical Mangrove | |||||||
| Coordinates | Lat. (o) | -23.89694 | Long. (o) | -46.20778 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005490 | Metagenome / Metatranscriptome | 399 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BMAI_12122002 | F005490 | GGAGG | VEQLLKDARRLGSVGTFFITLGWIAVIYALVAGLLWWIDLASRDAFNILEAFAISASAVGLPIFGAFVLAGLGYALRLFALYVASKAG* |
| ⦗Top⦘ |