


| Basic Information | |
|---|---|
| Taxon OID | 3300002495 Open in IMG/M |
| Scaffold ID | BRMGV_1053502 Open in IMG/M |
| Source Dataset Name | 454 Fosmid Sequence |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5481 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (37.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil → Mangrove Soil Microbial Communities From Bertioga, Brazil, Sampling Enzymes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bertioga - SP | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .3 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009818 | Metagenome / Metatranscriptome | 312 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BRMGV_10535023 | F009818 | AGGAG | MPEIYPKVTRATLKKGAKRTSEGKGRVALPGVKTDAKHVNATDKCGYKANRELAEMISKAVEAKKSADKNGAHFVLGWRLYPNRGHPRWKRKDVHSCGCGCGCSS* |
| ⦗Top⦘ |