NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M2t2FKB2_1860465

Scaffold M2t2FKB2_1860465


Overview

Basic Information
Taxon OID3300002140 Open in IMG/M
Scaffold IDM2t2FKB2_1860465 Open in IMG/M
Source Dataset NameMarine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2FKB2 (112f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2149
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.305Long. (o)20.0745Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013139Metagenome / Metatranscriptome274Y

Sequences

Protein IDFamilyRBSSequence
M2t2FKB2_18604652F013139GAGMPVYISEHITDEMIELFLKSGESLSVNTGIMSEQVVLPYLETHFESKGFVANADGYDHLFESGIRNEHKKLAIRKTSATAKNIGKNKEGKCDTISFHHPRVNGIYVIESNTFFEHAILNYDKTGNCYDVNFYSDMQLIGKGKRIGCNAWKNTEMLIKHADLIAL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.