


| Basic Information | |
|---|---|
| Taxon OID | 3300002039 Open in IMG/M |
| Scaffold ID | LBB32012_10033882 Open in IMG/M |
| Source Dataset Name | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1630 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Long Bay, Sydney, Australia | |||||||
| Coordinates | Lat. (o) | -33.57 | Long. (o) | 151.15 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002549 | Metagenome / Metatranscriptome | 549 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LBB32012_100338823 | F002549 | N/A | MSKLLKILGVGATPLIDKAVEVADKFIDTPEEKKAFIKEAYEQEVQDRKEARELGKNKSTPDVLTYITLVIACGLGVAIFTDIINWSTLTEVQKGLITTFSGFFLRTLGDVYGYWFGSSMGSEGKTHDLTKLM |
| ⦗Top⦘ |