


| Basic Information | |
|---|---|
| Taxon OID | 3300001848 Open in IMG/M |
| Scaffold ID | RCM47_1007743 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7796 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (12.50%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Santar?m, Para, Brazil | |||||||
| Coordinates | Lat. (o) | -2.484383 | Long. (o) | -55.0075 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060705 | Metagenome / Metatranscriptome | 132 | N |
| F062696 | Metagenome | 130 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| RCM47_100774314 | F062696 | N/A | MVKSLCKTFPYSSLADSPCYLLKIKMDGRYRIFYTLCLVSCLTSCSSEHRLLRLLKNHPLLYETFRYDSIRVKTALVQDSIFFFHKEKDTLYFNNATIYRNSDTIRLRQSCPPCTTYITKQILQPTQKYIKEKGYKRTLREKLEDAIFPIIIGILFGFIVTRK* |
| RCM47_10077437 | F060705 | N/A | MAISSLNFIISQFETEKYRYFAIYDEDGDRVYLQNDLIDVESAISKLKNFFKDNQGYYTIYVMSKKLLNKNNLKSRDDNTIAKYNVEVSMPVLPQGVNGLTGMGGSSMLPPDDPRSNAPNMFQLLGQMSQVEQQMKLMEKDHQHYREVKELQDRIAKMEEESSKAKGMGAIVDRLGEQFSDPNVLLGLISGVSQLFKKESVVPMHGVSREDIMPMNGVDEQVINNISTRREKMVGAVNFLRQHDKDFPENISRLAELAKNKPAIYSMAVSYLNNL* |
| ⦗Top⦘ |