


| Basic Information | |
|---|---|
| Taxon OID | 3300001754 Open in IMG/M |
| Scaffold ID | CSTRM28_101928 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Belvaux, Luxembourg - M28 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1404 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belvaux, Luxembourg | |||||||
| Coordinates | Lat. (o) | 49.506095 | Long. (o) | 5.943536 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015738 | Metagenome / Metatranscriptome | 252 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CSTRM28_1019284 | F015738 | GAGG | VPESDRPPAVMWSRVDTGLYQELEDAIREVFPGESDRVRLAAVEAWGVVMNRVPESGRVEGASWCRHFDRPIDHHLVKEDRPACIEERNGCGNCPESTYRVRRGTDR* |
| ⦗Top⦘ |