


| Basic Information | |
|---|---|
| Taxon OID | 3300001721 Open in IMG/M |
| Scaffold ID | JGI24528J20060_1008599 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Pacific Ocean - LP-54 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 621 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 49.5673 | Long. (o) | -138.6705 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055788 | Metagenome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24528J20060_10085993 | F055788 | N/A | MCYSVAGTCFPPMNEQLYNSHRECALNGYSKAHEFITTMPKEHVESNRTFIKFWCLPQKVKTNEEAT* |
| ⦗Top⦘ |