


| Basic Information | |
|---|---|
| Taxon OID | 3300001682 Open in IMG/M |
| Scaffold ID | SAHD_10002187 Open in IMG/M |
| Source Dataset Name | Cattle waste upflow reactor |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 59330 |
| Total Scaffold Genes | 76 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 55 (72.37%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Activated Sludge → Activated Sludge Microbial Communities From The University Of Illinois, Usa, From Bioreactors Seeded With Cattle Waste |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: University of Illionis | |||||||
| Coordinates | Lat. (o) | 40.103885 | Long. (o) | -88.225087 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046098 | Metagenome / Metatranscriptome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SAHD_1000218750 | F046098 | AGGA | MRIILILAAIVLLIVGILGLFPSVGWAAVPLWRAILEIVVGGLVLIVGIRKR* |
| ⦗Top⦘ |